(data stored in ACNUC7421 zone)

EMBL: CP001600.PE462

CP001600.PE462       Location/Qualifiers
FT   CDS             complement(492848..493192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0498"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67733"
FT                   /db_xref="GOA:C5BH50"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH50"
FT                   /protein_id="ACR67733.1"
FT                   /translation="MIGPGMIGLFSSPYIAIALLCIGGFAHQALSGSLITLSSNIFDRN
FT                   EAATANGLTGMAAWTVSTLFALVSSTLTNTLDFSPRLATLGVFDLLDVLIIWTVLQNCT
FT                   ANDPLSLLPG"
     MIGPGMIGLF SSPYIAIALL CIGGFAHQAL SGSLITLSSN IFDRNEAATA NGLTGMAAWT        60
     VSTLFALVSS TLTNTLDFSP RLATLGVFDL LDVLIIWTVL QNCTANDPLS LLPG             114
//

If you have problems or comments...

PBIL Back to PBIL home page