(data stored in ACNUC7421 zone)

EMBL: CP001600.PE463

CP001600.PE463       Location/Qualifiers
FT   CDS             complement(493221..493370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0499"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67734"
FT                   /db_xref="GOA:C5BH51"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH51"
FT                   /protein_id="ACR67734.1"
FT                   /translation="MFKAYGFNLQEIAMFAWIPVLFADLGCVIGGYPDSTVSEVLQIQP
FT                   ARLP"
     MFKAYGFNLQ EIAMFAWIPV LFADLGCVIG GYPDSTVSEV LQIQPARLP                    49
//

If you have problems or comments...

PBIL Back to PBIL home page