(data stored in ACNUC7421 zone)

EMBL: CP001600.PE464

CP001600.PE464       Location/Qualifiers
FT   CDS             493456..493587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67735"
FT                   /db_xref="GOA:C5BH52"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH52"
FT                   /protein_id="ACR67735.1"
FT                   /translation="MQNLPGRYVGRVIAIILSCLVAQNVLTFFVAPAILTLGLFVEE"
     MQNLPGRYVG RVIAIILSCL VAQNVLTFFV APAILTLGLF VEE                          43
//

If you have problems or comments...

PBIL Back to PBIL home page