(data stored in ACNUC7421 zone)

EMBL: CP001600.PE465

CP001600.PE465       Location/Qualifiers
FT   CDS             complement(493832..494044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0501"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67736"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH53"
FT                   /protein_id="ACR67736.1"
FT                   /translation="MIGMVTIGVVLGYLTRNAIAAPAWKTPCVSQSNIIATYSACDTIM
FT                   QPVAGYMLDPLGTQIDYAVFTVIWT"
     MIGMVTIGVV LGYLTRNAIA APAWKTPCVS QSNIIATYSA CDTIMQPVAG YMLDPLGTQI        60
     DYAVFTVIWT                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page