(data stored in ACNUC7421 zone)

EMBL: CP001600.PE470

CP001600.PE470       Location/Qualifiers
FT   CDS             complement(499748..500989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0506"
FT                   /product="transporter, dicarboxylate/amino acid:cation (Na+
FT                   or H+) symporter (DAACS) family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67741"
FT                   /db_xref="GOA:C5BH58"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BH58"
FT                   /protein_id="ACR67741.1"
FT                   /translation="MEKHSGFVRFITRGSLVGQILVGLVLGIALASFSQSGAIAAGLLG
FT                   TLFVSALKAVAPVLVFILVAASIANHRQGQKTNMRPIVLLYLLGTFAAALVAVVVSFAF
FT                   PSQLALVSHTNDITPPGGIVEVLQSLLMNVVDNPFHALASGNFIGILAWAIGLGVALRH
FT                   ASDTTKRVVGDLSYGVTFIVRVVIRFAPLGIFGLVSSTLAETGFDALWGYAHLLMVLIG
FT                   AMLLVALVLNPLIVFWKIRRNPYPLVFTCLRESGLTAFFTRSSAANIPVNMELCKKLGL
FT                   NEDTYAVSIPLGATINMAGAAITITVLTLAAAHTLEISVDLPTALLLSLVAAVCACGAS
FT                   GVAGGSLLLIPLACSLFGISSDIAMQVVAVGFIIGVLQDSCETALNSSTDVLFTATACV
FT                   AAEESTGDSAAELG"
     MEKHSGFVRF ITRGSLVGQI LVGLVLGIAL ASFSQSGAIA AGLLGTLFVS ALKAVAPVLV        60
     FILVAASIAN HRQGQKTNMR PIVLLYLLGT FAAALVAVVV SFAFPSQLAL VSHTNDITPP       120
     GGIVEVLQSL LMNVVDNPFH ALASGNFIGI LAWAIGLGVA LRHASDTTKR VVGDLSYGVT       180
     FIVRVVIRFA PLGIFGLVSS TLAETGFDAL WGYAHLLMVL IGAMLLVALV LNPLIVFWKI       240
     RRNPYPLVFT CLRESGLTAF FTRSSAANIP VNMELCKKLG LNEDTYAVSI PLGATINMAG       300
     AAITITVLTL AAAHTLEISV DLPTALLLSL VAAVCACGAS GVAGGSLLLI PLACSLFGIS       360
     SDIAMQVVAV GFIIGVLQDS CETALNSSTD VLFTATACVA AEESTGDSAA ELG              413
//

If you have problems or comments...

PBIL Back to PBIL home page