(data stored in ACNUC7421 zone)

EMBL: CP001600.PE471

CP001600.PE471       Location/Qualifiers
FT   CDS             complement(501338..502306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0507"
FT                   /product="Integral membrane protein TerC family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67742"
FT                   /db_xref="GOA:C5BH59"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH59"
FT                   /protein_id="ACR67742.1"
FT                   /translation="MLNSVGTPWLWGSFALIILIMLAIDLLLQGRRGAQAMTMRQAAVW
FT                   SLVWVSLALLFNAGLWFYLSETLGRAAANQQALAFLTGYLIEKALAVDNVFVWLMLFSY
FT                   FSVPASMQRRVLVYGVLGAIILRTVMIFAGSWLVTQFQWILYLFGAFLLFTGVKMAMAR
FT                   DDEGDLGERPLVRWLRRHLRMTDSIESEHFFTRRSGMLFATPLLLVLILVELSDVIFAV
FT                   DSIPAIFAVTTDPFLVLTSNLFAILGLRAMYFLLAGVAERFTLLKYGLAAILTFIGIKM
FT                   LIVDFYHIPIAFSLGIVAGILALTLLINAWVNHRRTSCALR"
     MLNSVGTPWL WGSFALIILI MLAIDLLLQG RRGAQAMTMR QAAVWSLVWV SLALLFNAGL        60
     WFYLSETLGR AAANQQALAF LTGYLIEKAL AVDNVFVWLM LFSYFSVPAS MQRRVLVYGV       120
     LGAIILRTVM IFAGSWLVTQ FQWILYLFGA FLLFTGVKMA MARDDEGDLG ERPLVRWLRR       180
     HLRMTDSIES EHFFTRRSGM LFATPLLLVL ILVELSDVIF AVDSIPAIFA VTTDPFLVLT       240
     SNLFAILGLR AMYFLLAGVA ERFTLLKYGL AAILTFIGIK MLIVDFYHIP IAFSLGIVAG       300
     ILALTLLINA WVNHRRTSCA LR                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page