(data stored in ACNUC7421 zone)

EMBL: CP001600.PE472

CP001600.PE472       Location/Qualifiers
FT   CDS             502691..503599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0509"
FT                   /product="Integral membrane protein DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67743"
FT                   /db_xref="GOA:C5BH60"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH60"
FT                   /protein_id="ACR67743.1"
FT                   /translation="MEVARKTNLLAIAGLIALTLIWSYNWIAMKQVTQYIGAFDFTALR
FT                   CVCGALLLLLVLRLRGHGMRPTPFGYTLAIALLQTCGMVGLAQWALMSGGAGKVAILSY
FT                   TMPFWVVIMAALFLGERMRRLQYAAIAVAALGLLLVLQPWKLDLSSLKSALLAVLSGIS
FT                   WGASAIVAKRMYARYPGVDLLGLTTWQMLYAAVVMSAVAWLVPQRSVDWQPYVFWALAY
FT                   SAILATALAWSLWLFVLKNLSAGIASLSTLAVPVCGVLFSWWLLGEDPGPVEGSGIVLI
FT                   VLALAAISIKRQGPQAQSTRR"
     MEVARKTNLL AIAGLIALTL IWSYNWIAMK QVTQYIGAFD FTALRCVCGA LLLLLVLRLR        60
     GHGMRPTPFG YTLAIALLQT CGMVGLAQWA LMSGGAGKVA ILSYTMPFWV VIMAALFLGE       120
     RMRRLQYAAI AVAALGLLLV LQPWKLDLSS LKSALLAVLS GISWGASAIV AKRMYARYPG       180
     VDLLGLTTWQ MLYAAVVMSA VAWLVPQRSV DWQPYVFWAL AYSAILATAL AWSLWLFVLK       240
     NLSAGIASLS TLAVPVCGVL FSWWLLGEDP GPVEGSGIVL IVLALAAISI KRQGPQAQST       300
     RR                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page