(data stored in ACNUC7421 zone)

EMBL: CP001600.PE474

CP001600.PE474       Location/Qualifiers
FT   CDS             complement(504664..505167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0511"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67745"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH62"
FT                   /protein_id="ACR67745.1"
FT                   /translation="MTHLSYLVGYPEPLLAQVRTLLEQKRLGDTLRRRYPERHAITTDR
FT                   ALYDYAQRLKNHYMRNTPPLSRVQYDSRIQVIQQALGLHRAVSRVQGNRLKAKAEIRIA
FT                   SLFRQGPEALLRMIVVHELAHLREKNHDKAFYSLCCHMEPNYHQLEFDARLYLTCLDVE
FT                   GSVY"
     MTHLSYLVGY PEPLLAQVRT LLEQKRLGDT LRRRYPERHA ITTDRALYDY AQRLKNHYMR        60
     NTPPLSRVQY DSRIQVIQQA LGLHRAVSRV QGNRLKAKAE IRIASLFRQG PEALLRMIVV       120
     HELAHLREKN HDKAFYSLCC HMEPNYHQLE FDARLYLTCL DVEGSVY                     167
//

If you have problems or comments...

PBIL Back to PBIL home page