(data stored in ACNUC7421 zone)

EMBL: CP001600.PE477

CP001600.PE477       Location/Qualifiers
FT   CDS             complement(507768..509132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0514"
FT                   /product="sensory histidine kinase QseC, putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67748"
FT                   /db_xref="GOA:C5BH65"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH65"
FT                   /protein_id="ACR67748.1"
FT                   /translation="MRHLPRQLTHSLRARLTGGFLILVLLVWSSASALTWYQTRDALNE
FT                   LFDTQQMLFAKRLLAFDLSQLKHPLQLPQSHDLLHKHRGDQDKDALAFAIFNADGRMLL
FT                   NDGDNGDNLVYRYQGDGFTDGYLDNDDDSWRLLWLTTPDGRYRILVGQEWDYRNDMALS
FT                   IVGGQMIPWLVALPVMVILLLLVVSRGLAPLHRLAAALGRRRPDDATPLPRDAIPSEVW
FT                   PVVESLNTLFSRTNAQMVRERRFTSDAAHELRTPLAALRVQAEVVQLAQDDIALRQRAL
FT                   GQLEQGIDRATRLVDQLLTLSRLDSLSQLDDVQPRVLAELLQTAVIDMDAKAHAAGVAL
FT                   ALSVDDPKVRRRIQPLLFSLLIRNLLDNAICYSPAGSQVTLRLTSHRLQITDNGTGVSD
FT                   AVLQRLGERFYRPPGQEKTGSGLGLSIVRQIASLHEMQVQFSHAPGGGFQVTLRW"
     MRHLPRQLTH SLRARLTGGF LILVLLVWSS ASALTWYQTR DALNELFDTQ QMLFAKRLLA        60
     FDLSQLKHPL QLPQSHDLLH KHRGDQDKDA LAFAIFNADG RMLLNDGDNG DNLVYRYQGD       120
     GFTDGYLDND DDSWRLLWLT TPDGRYRILV GQEWDYRNDM ALSIVGGQMI PWLVALPVMV       180
     ILLLLVVSRG LAPLHRLAAA LGRRRPDDAT PLPRDAIPSE VWPVVESLNT LFSRTNAQMV       240
     RERRFTSDAA HELRTPLAAL RVQAEVVQLA QDDIALRQRA LGQLEQGIDR ATRLVDQLLT       300
     LSRLDSLSQL DDVQPRVLAE LLQTAVIDMD AKAHAAGVAL ALSVDDPKVR RRIQPLLFSL       360
     LIRNLLDNAI CYSPAGSQVT LRLTSHRLQI TDNGTGVSDA VLQRLGERFY RPPGQEKTGS       420
     GLGLSIVRQI ASLHEMQVQF SHAPGGGFQV TLRW                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page