(data stored in ACNUC7421 zone)

EMBL: CP001600.PE479

CP001600.PE479       Location/Qualifiers
FT   CDS             510004..510405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0516"
FT                   /product="Protein unknown function (DUF388)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67750"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH67"
FT                   /protein_id="ACR67750.1"
FT                   /translation="MKKGAAIFAILALCSAPVLAQTGGFSGPGAMQQAQDTQQSGGFVS
FT                   GQQAVTTVAKAKDLSDNSWVVLQGNIEQRVRGDHYTFRDATGTIEVEIDHKYWNGQTIT
FT                   PKDKVEIQGEIDKDWSTTKIDVKRLHKMN"
     MKKGAAIFAI LALCSAPVLA QTGGFSGPGA MQQAQDTQQS GGFVSGQQAV TTVAKAKDLS        60
     DNSWVVLQGN IEQRVRGDHY TFRDATGTIE VEIDHKYWNG QTITPKDKVE IQGEIDKDWS       120
     TTKIDVKRLH KMN                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page