(data stored in ACNUC7421 zone)

EMBL: CP001600.PE483

CP001600.PE483       Location/Qualifiers
FT   CDS             514884..518132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0520"
FT                   /product="Type III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67754"
FT                   /db_xref="GOA:C5BH71"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH71"
FT                   /protein_id="ACR67754.1"
FT                   /translation="MSMDSTKERIFQDEMIAQMIDRGWVRGKTDGYDRERALYSQDALT
FT                   FVQTTQPQEWEKFTKVYPSDTERHFLDALVAQLKKADINATDMLSRTYGTLGVLRHGIK
FT                   SHNARFSLCQFKPEHNLNPQTLTRYQQNICRLVPELVYSPHASNGAFAETGVKAKKWRI
FT                   DLVLFVNGLPIATLELKSEFKQTVQNAITQYKKTRLPKDPGTNKPEPLLTFKRGALVHF
FT                   AVSQYDVFMTTRLDGDKTFFLPFNKGTHDGGAGNDIPEDANDYATSYLWKEVLLPDNLL
FT                   KILASFMHLQIVEKENALGLKYKSESLIFPRYHQWDVVNKLITAATVEGTGNKYLIQHS
FT                   AGSGKSNSIAWTAHQLSRLYDENGEKQFHSVIVVTDRTVLDDQLQDTIYQFEHQDGVVG
FT                   RINNKEGDGSKSEKLASALENSQPIIIVTIQTFPFVLKAIENSVSLKQRKYAVIADEAH
FT                   SSQSGSTARQLKEVLMTEEADDDVEMSSEDILDATVAARRGSSNLNYYAFTATPKAKTL
FT                   ELFGRRPNPLEPASKTNKPEAFHVYSMRQAIEEGFILDVLKNYTNYKVAYKLLQKLGDP
FT                   DREVDSKKAKVKLNQWVSLHDYNVSQKVRVIVEHFRQHVMHLLAGQAKAMVVTSSRKAA
FT                   VRYKLAFDKYIAERKYAKISAMVAFSGEVEFHEDDHNSLALLHQKFTEINMNPGLKGRD
FT                   MRKAFDTDEYQVMLVANKFQTGFDQPKLCAMYVDKKLGGVECVQTLSRLNRTYPGKAQS
FT                   GTFVLDFYNEPEDILGAFQPYYQTAELTDVSDPQLVFELYEKLRTSGIFLWNEVEQFCT
FT                   AFFSKNKSNAAISNICKPAVQRWKNRYTSAIDAYLLAKEMFERTRKTGDIVLITNAENT
FT                   FKECEKEKSKLDIFKKDLGSFVRFYEFMSQIVDYDDKNLEKLSLFARHLRPLLHEQRIE
FT                   EDEIDLSNVEMSHYRLSKLHEQHLKLQEDAEDDKIKPGNEVGTAKPKDKKEEFLSNILA
FT                   RLNELFVTDNLTDKDMINYAFAVRDKLSENQAVMTQIANNTREQAMLGDFPQAIDDAVM
FT                   DSNDAQQEMMLQYLSNPELAKGFARVVFDMLKGA"
     MSMDSTKERI FQDEMIAQMI DRGWVRGKTD GYDRERALYS QDALTFVQTT QPQEWEKFTK        60
     VYPSDTERHF LDALVAQLKK ADINATDMLS RTYGTLGVLR HGIKSHNARF SLCQFKPEHN       120
     LNPQTLTRYQ QNICRLVPEL VYSPHASNGA FAETGVKAKK WRIDLVLFVN GLPIATLELK       180
     SEFKQTVQNA ITQYKKTRLP KDPGTNKPEP LLTFKRGALV HFAVSQYDVF MTTRLDGDKT       240
     FFLPFNKGTH DGGAGNDIPE DANDYATSYL WKEVLLPDNL LKILASFMHL QIVEKENALG       300
     LKYKSESLIF PRYHQWDVVN KLITAATVEG TGNKYLIQHS AGSGKSNSIA WTAHQLSRLY       360
     DENGEKQFHS VIVVTDRTVL DDQLQDTIYQ FEHQDGVVGR INNKEGDGSK SEKLASALEN       420
     SQPIIIVTIQ TFPFVLKAIE NSVSLKQRKY AVIADEAHSS QSGSTARQLK EVLMTEEADD       480
     DVEMSSEDIL DATVAARRGS SNLNYYAFTA TPKAKTLELF GRRPNPLEPA SKTNKPEAFH       540
     VYSMRQAIEE GFILDVLKNY TNYKVAYKLL QKLGDPDREV DSKKAKVKLN QWVSLHDYNV       600
     SQKVRVIVEH FRQHVMHLLA GQAKAMVVTS SRKAAVRYKL AFDKYIAERK YAKISAMVAF       660
     SGEVEFHEDD HNSLALLHQK FTEINMNPGL KGRDMRKAFD TDEYQVMLVA NKFQTGFDQP       720
     KLCAMYVDKK LGGVECVQTL SRLNRTYPGK AQSGTFVLDF YNEPEDILGA FQPYYQTAEL       780
     TDVSDPQLVF ELYEKLRTSG IFLWNEVEQF CTAFFSKNKS NAAISNICKP AVQRWKNRYT       840
     SAIDAYLLAK EMFERTRKTG DIVLITNAEN TFKECEKEKS KLDIFKKDLG SFVRFYEFMS       900
     QIVDYDDKNL EKLSLFARHL RPLLHEQRIE EDEIDLSNVE MSHYRLSKLH EQHLKLQEDA       960
     EDDKIKPGNE VGTAKPKDKK EEFLSNILAR LNELFVTDNL TDKDMINYAF AVRDKLSENQ      1020
     AVMTQIANNT REQAMLGDFP QAIDDAVMDS NDAQQEMMLQ YLSNPELAKG FARVVFDMLK      1080
     GA                                                                     1082
//

If you have problems or comments...

PBIL Back to PBIL home page