(data stored in ACNUC7421 zone)

EMBL: CP001600.PE485

CP001600.PE485       Location/Qualifiers
FT   CDS             518876..519067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0523"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67756"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH73"
FT                   /protein_id="ACR67756.1"
FT                   /translation="MRYQPGTEPGPGDHFANPRNRFWSVIHLAGFTDRPLAPQAEPHLL
FT                   IPAVGLSRWYRVPDGNGC"
     MRYQPGTEPG PGDHFANPRN RFWSVIHLAG FTDRPLAPQA EPHLLIPAVG LSRWYRVPDG        60
     NGC                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page