(data stored in ACNUC7421 zone)

EMBL: CP001600.PE488

CP001600.PE488       Location/Qualifiers
FT   CDS             complement(523445..523660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0526"
FT                   /product="30S ribosomal protein S21, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67759"
FT                   /db_xref="GOA:C5BHG0"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHG0"
FT                   /protein_id="ACR67759.1"
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGILAEVRRREFYEKPTTER
FT                   KRAKASAVKRHAKKLARENARRTRLY"
     MPVIKVRENE PFDVALRRFK RSCEKAGILA EVRRREFYEK PTTERKRAKA SAVKRHAKKL        60
     ARENARRTRL Y                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page