(data stored in ACNUC7421 zone)

EMBL: CP001600.PE490

CP001600.PE490       Location/Qualifiers
FT   CDS             complement(524921..525589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0528"
FT                   /product="conserved hypothetical protein TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67761"
FT                   /db_xref="GOA:C5BHG2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHG2"
FT                   /protein_id="ACR67761.1"
FT                   /translation="MSATALGMIIFAYLCGSISSAILVCKAAGLPDPRENGSGNPGATN
FT                   VLRNGGRLAAAAVLIFDVLKGMIPVWLAYTLEMSPFYLGLTAIAACLGHIYPVFFRFRG
FT                   GKGVATAFGAIAPIGWDLTGLMVGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFT
FT                   FPVAMLSCLILVRHHDNIQRLWRGKEGKIWRKKGAKSAQNSERPASASPPHDDEPQTPR
FT                   "
     MSATALGMII FAYLCGSISS AILVCKAAGL PDPRENGSGN PGATNVLRNG GRLAAAAVLI        60
     FDVLKGMIPV WLAYTLEMSP FYLGLTAIAA CLGHIYPVFF RFRGGKGVAT AFGAIAPIGW       120
     DLTGLMVGTW LLTVLLSGYS SLGAIVSALI APFYVWWFKP QFTFPVAMLS CLILVRHHDN       180
     IQRLWRGKEG KIWRKKGAKS AQNSERPASA SPPHDDEPQT PR                          222
//

If you have problems or comments...

PBIL Back to PBIL home page