(data stored in ACNUC7421 zone)

EMBL: CP001600.PE493

CP001600.PE493       Location/Qualifiers
FT   CDS             complement(527034..528278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0531"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67764"
FT                   /db_xref="GOA:C5BHG5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHG5"
FT                   /protein_id="ACR67764.1"
FT                   /translation="MKTYLVGGAVRDKYLQLPTQDRDWVVVGAAPQTLLAQGYQQVGKD
FT                   FPVFLHPRSKEEYALARTERKAGQGYTGFSTYFAPDVTLEQDLLRRDLTINAMAEDDEG
FT                   QLIDPYGGLQDLQQRQLRHVSEAFVEDPLRVLRVARFAARFAPLGFEVAAPTLALMQQM
FT                   SQQGELAHLTPERVWLETEKALSGPVPQVYFQVLRDCGALAVLFPEIDRLFGVPAPAQW
FT                   HPEIDTGIHTLLTLAMASHLSDDVAVRFAALTHDVGKGLTNPNFWPHHHGHGPAGVRLV
FT                   REMCQRLRTPNPVRDLALLVAEYHDLIHTVERLRPATLLKLLDTIDVWRRPQRLQQMIL
FT                   CSEADARGRTGLEDQPYPQAGYLRAAYHQAAQVAVCNVITDGFQGAAIREELQTRRLQA
FT                   LKSWKAAQEAALNAE"
     MKTYLVGGAV RDKYLQLPTQ DRDWVVVGAA PQTLLAQGYQ QVGKDFPVFL HPRSKEEYAL        60
     ARTERKAGQG YTGFSTYFAP DVTLEQDLLR RDLTINAMAE DDEGQLIDPY GGLQDLQQRQ       120
     LRHVSEAFVE DPLRVLRVAR FAARFAPLGF EVAAPTLALM QQMSQQGELA HLTPERVWLE       180
     TEKALSGPVP QVYFQVLRDC GALAVLFPEI DRLFGVPAPA QWHPEIDTGI HTLLTLAMAS       240
     HLSDDVAVRF AALTHDVGKG LTNPNFWPHH HGHGPAGVRL VREMCQRLRT PNPVRDLALL       300
     VAEYHDLIHT VERLRPATLL KLLDTIDVWR RPQRLQQMIL CSEADARGRT GLEDQPYPQA       360
     GYLRAAYHQA AQVAVCNVIT DGFQGAAIRE ELQTRRLQAL KSWKAAQEAA LNAE             414
//

If you have problems or comments...

PBIL Back to PBIL home page