(data stored in ACNUC7421 zone)

EMBL: CP001600.PE494

CP001600.PE494       Location/Qualifiers
FT   CDS             complement(528395..529012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0532"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67765"
FT                   /db_xref="GOA:C5BHG6"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG6"
FT                   /protein_id="ACR67765.1"
FT                   /translation="MHLFCRLLLPLLSLCLTFQSHAEEQRFISDALSTYVHSGPGNQYR
FT                   ISGTINAGDPVTLLDINQQSQFAQIRDAKGRSGWLPLDQLSNQPSLRTRVPALEAQLSA
FT                   LTAKLSHIDGEWQQKTAEMQSKVAGSDDAIARLQAENQQLRQQLSSAQKNLGALNSQLD
FT                   DKKRAIILQWFLYGGGVAGAGLLLGLLLPRLLPRRRKERWMN"
     MHLFCRLLLP LLSLCLTFQS HAEEQRFISD ALSTYVHSGP GNQYRISGTI NAGDPVTLLD        60
     INQQSQFAQI RDAKGRSGWL PLDQLSNQPS LRTRVPALEA QLSALTAKLS HIDGEWQQKT       120
     AEMQSKVAGS DDAIARLQAE NQQLRQQLSS AQKNLGALNS QLDDKKRAII LQWFLYGGGV       180
     AGAGLLLGLL LPRLLPRRRK ERWMN                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page