(data stored in ACNUC7421 zone)

EMBL: CP001600.PE495

CP001600.PE495       Location/Qualifiers
FT   CDS             complement(529221..530486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0533"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67766"
FT                   /db_xref="GOA:C5BHG7"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG7"
FT                   /protein_id="ACR67766.1"
FT                   /translation="MEIIANHGSLLIMVAAFFGLLMAIGIGANDVANAMGTSVGARAVT
FT                   IRQAIVIAMIFEFAGAYLAGGEVTQTIRSGIIDTNAFAGHPQTLVFGMMASLLAAGIWL
FT                   IVASLMGWPVSTTHSIIGAIIGFACVSVGPEAVEWDGVKGIVGSWIITPLISGVVAYGI
FT                   FLSAQRLIFNTENPFANARRFGPVYMFLTALVISLVTIKKGLKHVGLHLTDGETWLISL
FT                   LVSLLVMLGGYLYLSRKSFTDDADEQDHFRGVERVFSLLMVITACAMAFAHGSNDVANA
FT                   IGPLSAIVAIVRDPSVLAGTSPIVWWILPLGGIGIVVGLALMGRRVMETVGTGITDLTP
FT                   SRGFAAQFATASTVVIASGTGLPISTTQTLVGAVLGVGFARGIAALNLNVVRNIVASWI
FT                   VTLPAGAALSIALFYLLQAVFG"
     MEIIANHGSL LIMVAAFFGL LMAIGIGAND VANAMGTSVG ARAVTIRQAI VIAMIFEFAG        60
     AYLAGGEVTQ TIRSGIIDTN AFAGHPQTLV FGMMASLLAA GIWLIVASLM GWPVSTTHSI       120
     IGAIIGFACV SVGPEAVEWD GVKGIVGSWI ITPLISGVVA YGIFLSAQRL IFNTENPFAN       180
     ARRFGPVYMF LTALVISLVT IKKGLKHVGL HLTDGETWLI SLLVSLLVML GGYLYLSRKS       240
     FTDDADEQDH FRGVERVFSL LMVITACAMA FAHGSNDVAN AIGPLSAIVA IVRDPSVLAG       300
     TSPIVWWILP LGGIGIVVGL ALMGRRVMET VGTGITDLTP SRGFAAQFAT ASTVVIASGT       360
     GLPISTTQTL VGAVLGVGFA RGIAALNLNV VRNIVASWIV TLPAGAALSI ALFYLLQAVF       420
     G                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page