(data stored in ACNUC7421 zone)

EMBL: CP001600.PE496

CP001600.PE496       Location/Qualifiers
FT   CDS             complement(530509..531192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0534"
FT                   /product="conserved hypothetical protein TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67767"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG8"
FT                   /protein_id="ACR67767.1"
FT                   /translation="MMPVNTILGLFAKSPLKPLQEHASRVHECCSLLVPFFAATAQQQW
FT                   DQAQEIREQISNLEKQADTLKREIRLKLPRGLFLPVDRGDMLELVTQQDRLANRAKDIA
FT                   GRVIGRRLQIPAVMQADFVSYLQRCLDATALSSKVIHEMDELLETGFRGREADLVEQMV
FT                   MELDHIEDDTDHQQILLRQTLLSLEHQLNPVDIMFLYQIIEWVGGLADKALRVGSRLEL
FT                   MLARS"
     MMPVNTILGL FAKSPLKPLQ EHASRVHECC SLLVPFFAAT AQQQWDQAQE IREQISNLEK        60
     QADTLKREIR LKLPRGLFLP VDRGDMLELV TQQDRLANRA KDIAGRVIGR RLQIPAVMQA       120
     DFVSYLQRCL DATALSSKVI HEMDELLETG FRGREADLVE QMVMELDHIE DDTDHQQILL       180
     RQTLLSLEHQ LNPVDIMFLY QIIEWVGGLA DKALRVGSRL ELMLARS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page