(data stored in ACNUC7421 zone)

EMBL: CP001600.PE497

CP001600.PE497       Location/Qualifiers
FT   CDS             531328..532644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0535"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67768"
FT                   /db_xref="GOA:C5BHG9"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG9"
FT                   /protein_id="ACR67768.1"
FT                   /translation="MTEKMTVEIELKFIALPSAVHELPASLARWPLQHTPAQALSNIYY
FT                   ETECQTLRRHDMGLRIRGCDGAYEMTLKTAGSDVGGLHQRPEYNVALDAPQLDLRRFPA
FT                   QVWPDGCDVDALQAALQPLFSTDFQRERWVVTYRESQIEVALDRGDICAAGEREALHEI
FT                   ELELLQGERGDLLAFAEQLLTLDGIRMGAMSKAARGYRLAAGNAALRRRAFPLLRPAVR
FT                   ASVEQGMSAALTQILAHWQYHEEAWLRGDAESRDGIQEALVALRQSLTLFGGIVPRKAS
FT                   ATLRAGLSALEAQIQQPACAAQTLCYGRESLTTQWALTRWLAESGWRAYLDAAGSAKLS
FT                   GSFKRFADIMLGRCGAELKALFALVRHPQEYQDKLPRLQHQILAIRLLGGAYGEAAVDG
FT                   YLAPWQTLAHAIAHPAAATPEAACAQALHQPAFWRNGAH"
     MTEKMTVEIE LKFIALPSAV HELPASLARW PLQHTPAQAL SNIYYETECQ TLRRHDMGLR        60
     IRGCDGAYEM TLKTAGSDVG GLHQRPEYNV ALDAPQLDLR RFPAQVWPDG CDVDALQAAL       120
     QPLFSTDFQR ERWVVTYRES QIEVALDRGD ICAAGEREAL HEIELELLQG ERGDLLAFAE       180
     QLLTLDGIRM GAMSKAARGY RLAAGNAALR RRAFPLLRPA VRASVEQGMS AALTQILAHW       240
     QYHEEAWLRG DAESRDGIQE ALVALRQSLT LFGGIVPRKA SATLRAGLSA LEAQIQQPAC       300
     AAQTLCYGRE SLTTQWALTR WLAESGWRAY LDAAGSAKLS GSFKRFADIM LGRCGAELKA       360
     LFALVRHPQE YQDKLPRLQH QILAIRLLGG AYGEAAVDGY LAPWQTLAHA IAHPAAATPE       420
     AACAQALHQP AFWRNGAH                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page