(data stored in ACNUC7421 zone)

EMBL: CP001600.PE500

CP001600.PE500       Location/Qualifiers
FT   CDS             536612..538045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0538"
FT                   /product="RfaE bifunctional protein, putative"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67771"
FT                   /db_xref="GOA:C5BHH2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHH2"
FT                   /protein_id="ACR67771.1"
FT                   /translation="MKVTLPDFRRAQVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVET
FT                   IEERPGGAANVAMNIASLGASARLVGLTGVDDAARALSTRLDEVHVECDFVAIPAQPTI
FT                   TKLRVLSRNQQLIRLDFEEGFGGVDPGPILARIRQALPQVGAVILSDYAKGALASVQAM
FT                   ICLARDAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGRCHSEQEIVDRGLALMER
FT                   FDLTALLVTRSEQGMTLLQRGIAPLHMPTQAQEVYDVTGAGDTVIGMLAASIAAGASLD
FT                   EACFLANAAAGVVVGKLGTSTVSPIELENAIRGRADTGFGVMTQEELKTAVLQARQRGE
FT                   KVVMTNGVFDILHAGHVSYLANARRLGDRLIVAVNSDASTSRLKGPERPVNPLVQRMLV
FT                   LAALEAVDWVIPFEEDTPQRIIAEILPDLLVKGGDYKPEEIAGGKEVIAAGGEVRVLNF
FT                   EDGCSTSNIINIIRQGQND"
     MKVTLPDFRR AQVLVVGDVM LDRYWYGPTS RISPEAPVPV VKVETIEERP GGAANVAMNI        60
     ASLGASARLV GLTGVDDAAR ALSTRLDEVH VECDFVAIPA QPTITKLRVL SRNQQLIRLD       120
     FEEGFGGVDP GPILARIRQA LPQVGAVILS DYAKGALASV QAMICLARDA GVPVLIDPKG       180
     TDFERYRGAT LLTPNLSEFE AVVGRCHSEQ EIVDRGLALM ERFDLTALLV TRSEQGMTLL       240
     QRGIAPLHMP TQAQEVYDVT GAGDTVIGML AASIAAGASL DEACFLANAA AGVVVGKLGT       300
     STVSPIELEN AIRGRADTGF GVMTQEELKT AVLQARQRGE KVVMTNGVFD ILHAGHVSYL       360
     ANARRLGDRL IVAVNSDAST SRLKGPERPV NPLVQRMLVL AALEAVDWVI PFEEDTPQRI       420
     IAEILPDLLV KGGDYKPEEI AGGKEVIAAG GEVRVLNFED GCSTSNIINI IRQGQND          477
//

If you have problems or comments...

PBIL Back to PBIL home page