(data stored in ACNUC7421 zone)

EMBL: CP001600.PE501

CP001600.PE501       Location/Qualifiers
FT   CDS             538077..538601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0539"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67772"
FT                   /db_xref="GOA:C5BHH3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH3"
FT                   /protein_id="ACR67772.1"
FT                   /translation="MAALKQELGLVQGVGLLSTSLLGTGVFAVPALAAQVAGNDSLWTW
FT                   PLLIVLVFPIAIGFAALGRHFPSAGGAAHFVGKAFGPHMARVTGWLFLSVIPVGLPASL
FT                   QIAAGFWQALFGWQGVALLVVELITLLTVWLLGMRGAGSSANLQTLIALLVVVLIAAVW
FT                   WRGGILPTQIP"
     MAALKQELGL VQGVGLLSTS LLGTGVFAVP ALAAQVAGND SLWTWPLLIV LVFPIAIGFA        60
     ALGRHFPSAG GAAHFVGKAF GPHMARVTGW LFLSVIPVGL PASLQIAAGF WQALFGWQGV       120
     ALLVVELITL LTVWLLGMRG AGSSANLQTL IALLVVVLIA AVWWRGGILP TQIP             174
//

If you have problems or comments...

PBIL Back to PBIL home page