(data stored in ACNUC7421 zone)

EMBL: CP001600.PE502

CP001600.PE502       Location/Qualifiers
FT   CDS             538653..539324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0540"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67773"
FT                   /db_xref="GOA:C5BHH4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH4"
FT                   /protein_id="ACR67773.1"
FT                   /translation="MFWCFVGLEAFAHLASEFRHPQRDFPRALLLGLLLAGAVYWACSV
FT                   AVLHFHAFGDGRAAAASLPGIVVQLFGRHALWVACVIGYLACFASLNVYIQSFARLVWS
FT                   QAQRRPQSRLAQLSARQAPLNALTAVMLCCLLCSLLIYLSGLSLDALIVYANGVFIMIY
FT                   LLCMLAGCRLLRGPARLMARMGSVLCLLLLAMVGVRSLYALGMLLLLYLLLPRRAVPHG
FT                   G"
     MFWCFVGLEA FAHLASEFRH PQRDFPRALL LGLLLAGAVY WACSVAVLHF HAFGDGRAAA        60
     ASLPGIVVQL FGRHALWVAC VIGYLACFAS LNVYIQSFAR LVWSQAQRRP QSRLAQLSAR       120
     QAPLNALTAV MLCCLLCSLL IYLSGLSLDA LIVYANGVFI MIYLLCMLAG CRLLRGPARL       180
     MARMGSVLCL LLLAMVGVRS LYALGMLLLL YLLLPRRAVP HGG                         223
//

If you have problems or comments...

PBIL Back to PBIL home page