(data stored in ACNUC7421 zone)

EMBL: CP001600.PE503

CP001600.PE503       Location/Qualifiers
FT   CDS             complement(539343..539609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0541"
FT                   /product="Protein of unknown function (DUF526)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67774"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH5"
FT                   /protein_id="ACR67774.1"
FT                   /translation="MIDPKKIEQIARQVHQSMPKGLREFGDDMEKRVRQILQQQLSRLD
FT                   LVNREDFDVQTQVLLRTREKLALLEQRVAALEARLNDAGDGQA"
     MIDPKKIEQI ARQVHQSMPK GLREFGDDME KRVRQILQQQ LSRLDLVNRE DFDVQTQVLL        60
     RTREKLALLE QRVAALEARL NDAGDGQA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page