(data stored in ACNUC7421 zone)

EMBL: CP001600.PE505

CP001600.PE505       Location/Qualifiers
FT   CDS             541084..541392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0543"
FT                   /product="Transposase IS200 like protein"
FT                   /note="Transposase IS200 like"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67776"
FT                   /db_xref="GOA:C5BHH7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH7"
FT                   /protein_id="ACR67776.1"
FT                   /translation="MFDQDAIEKLRIYFASVCADFDVELVEMDGERDHVHLLINYPPKL
FT                   AVSSLVNSLKGVSSRLLRRDRPDIAARYYYKGVLWTPSYFASSCGGAPISIIKQYIE"
     MFDQDAIEKL RIYFASVCAD FDVELVEMDG ERDHVHLLIN YPPKLAVSSL VNSLKGVSSR        60
     LLRRDRPDIA ARYYYKGVLW TPSYFASSCG GAPISIIKQY IE                          102
//

If you have problems or comments...

PBIL Back to PBIL home page