(data stored in ACNUC7421 zone)

EMBL: CP001600.PE508

CP001600.PE508       Location/Qualifiers
FT   CDS             543551..544336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0547"
FT                   /product="Catalytic LigB subunit of aromatic ring-opening
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67779"
FT                   /db_xref="GOA:C5BHI0"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI0"
FT                   /protein_id="ACR67779.1"
FT                   /translation="MNDATMPALFLAHGSPMNAIEDNPFSALWQRLGRELPRPKAIVAI
FT                   SAHWCTQGLWATAMAQPRTLHDFGGFPPALSALRYPAPGSPALARELQSLLATQYTLLL
FT                   DENGWGLDHGAWSLLVHLYPQADIPVIQLSLDPRQPAAYHYQLGQALAPLRQRGVLILG
FT                   SGNVVHNLGTLRWEAEVEPYPWARRFEEVVRQGLRERGEDAALLRFTDDPDATLANPTP
FT                   EHFLPLLPVLGCWDGTEPLRVFEQGIVMGSLSMLSLQIG"
     MNDATMPALF LAHGSPMNAI EDNPFSALWQ RLGRELPRPK AIVAISAHWC TQGLWATAMA        60
     QPRTLHDFGG FPPALSALRY PAPGSPALAR ELQSLLATQY TLLLDENGWG LDHGAWSLLV       120
     HLYPQADIPV IQLSLDPRQP AAYHYQLGQA LAPLRQRGVL ILGSGNVVHN LGTLRWEAEV       180
     EPYPWARRFE EVVRQGLRER GEDAALLRFT DDPDATLANP TPEHFLPLLP VLGCWDGTEP       240
     LRVFEQGIVM GSLSMLSLQI G                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page