(data stored in ACNUC7421 zone)

EMBL: CP001600.PE509

CP001600.PE509       Location/Qualifiers
FT   CDS             complement(545010..546050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0551"
FT                   /product="methyltransferase, small subunit domain protein"
FT                   /note="methyltransferase, small subunit domain"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67780"
FT                   /db_xref="GOA:C5BHI1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI1"
FT                   /protein_id="ACR67780.1"
FT                   /translation="MSAFTPASEVVLRHREEFEPRRVLFAGDLQDTLPAQFNAVEVRAH
FT                   TTQYHHWQALHTAMGDRCLFSLTISAEFAAGIDTLIYFWPKSKPEALFQLTQLLAQLPA
FT                   GCDVFIVGENRAGVRSAEEMASGMLTLNKIDSARRCGLYHGLLAQPPHFDLNDWWMSYD
FT                   TGSLRIATLPGVFSRDGLDIGSHLLLSSLPHGLKGRVLDVGCGAGVLSAAITRMSPETT
FT                   LTLSDVNAAALTASRQTLAQNEIDGEILASNVFSDISGRFDLIISNPPFHDGVQTSLLA
FT                   AQTLIRGAVSHLQLGGELRIVANAFLPYPQVLDAVFGRHEVVAQTGKFKVYSAILDRAA
FT                   LEQSRR"
     MSAFTPASEV VLRHREEFEP RRVLFAGDLQ DTLPAQFNAV EVRAHTTQYH HWQALHTAMG        60
     DRCLFSLTIS AEFAAGIDTL IYFWPKSKPE ALFQLTQLLA QLPAGCDVFI VGENRAGVRS       120
     AEEMASGMLT LNKIDSARRC GLYHGLLAQP PHFDLNDWWM SYDTGSLRIA TLPGVFSRDG       180
     LDIGSHLLLS SLPHGLKGRV LDVGCGAGVL SAAITRMSPE TTLTLSDVNA AALTASRQTL       240
     AQNEIDGEIL ASNVFSDISG RFDLIISNPP FHDGVQTSLL AAQTLIRGAV SHLQLGGELR       300
     IVANAFLPYP QVLDAVFGRH EVVAQTGKFK VYSAILDRAA LEQSRR                      346
//

If you have problems or comments...

PBIL Back to PBIL home page