(data stored in ACNUC7421 zone)

EMBL: CP001600.PE510

CP001600.PE510       Location/Qualifiers
FT   CDS             546246..546656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0552"
FT                   /product="DNA polymerase III, psi subunit, putative"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67781"
FT                   /db_xref="GOA:C5BHI2"
FT                   /db_xref="InterPro:IPR004615"
FT                   /db_xref="InterPro:IPR036654"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI2"
FT                   /protein_id="ACR67781.1"
FT                   /translation="MTSRRDQLLQQLGITQWVLRRPALLRGEIAITLSAQTRLLIVSEV
FT                   PLSPDDLLLCDILRALSLAAEQAVILTPEQYEMLGDRQRYLCWWLGEPASSEACLRSPA
FT                   LSALYHNPGAKRALWQQICHEQHHFFPDPGGH"
     MTSRRDQLLQ QLGITQWVLR RPALLRGEIA ITLSAQTRLL IVSEVPLSPD DLLLCDILRA        60
     LSLAAEQAVI LTPEQYEMLG DRQRYLCWWL GEPASSEACL RSPALSALYH NPGAKRALWQ       120
     QICHEQHHFF PDPGGH                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page