(data stored in ACNUC7421 zone)

EMBL: CP001600.PE511

CP001600.PE511       Location/Qualifiers
FT   CDS             546616..547062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0553"
FT                   /product="ribosomal-protein-alanine acetyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67782"
FT                   /db_xref="GOA:C5BHI3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI3"
FT                   /protein_id="ACR67782.1"
FT                   /translation="MSNTISSLIPADTDAAYAVECASHAFPWTHSTFLSNQGERYYNLK
FT                   LESQGQLAAFAITQVVLDEATLFNVAVAPAYQRQGLGRTLLQRLIDDLTERGVMTLWLE
FT                   VRDSNRAAIALYHALGFSEVSLRRNYYPTADGREDARIMALPLG"
     MSNTISSLIP ADTDAAYAVE CASHAFPWTH STFLSNQGER YYNLKLESQG QLAAFAITQV        60
     VLDEATLFNV AVAPAYQRQG LGRTLLQRLI DDLTERGVMT LWLEVRDSNR AAIALYHALG       120
     FSEVSLRRNY YPTADGREDA RIMALPLG                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page