(data stored in ACNUC7421 zone)

EMBL: CP001600.PE512

CP001600.PE512       Location/Qualifiers
FT   CDS             547258..548847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0554"
FT                   /product="peptide chain release factor 3, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67783"
FT                   /db_xref="GOA:C5BHI4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHI4"
FT                   /protein_id="ACR67783.1"
FT                   /translation="MSPSEYAREVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQVAGT
FT                   VKGRGSSQHAKSDWMEMEKQRGISITTSVMQFPYHDCLVNLLDTPGHEDFSEDTYRTLT
FT                   AVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVESELR
FT                   IACAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEVRVIKGLDNPLLDTAVGED
FT                   LAAQLREELELVQGASTEFEEEAFLNGQLTPVFFGTALGNFGVDHMLDGLVAWAPAPMP
FT                   RMTDVRKVSADEEKFSGFVFKIQANMDPKHRDRVAFMRVVSGRYDKGMKLRQVRTGKDV
FT                   VIADALTFMAGDRAHVEEAYPGDIIGLHNHGTIQIGDTFTQGEEMKFTGIPNFAPELFR
FT                   RIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPVANNDLIVGAVGVLQFDVVVARLKSEYN
FT                   VEAIYESVNVSTARWVECDDVKKFDEFQRKNELHLALDGGDNLAYIAPTMVNLNLTQER
FT                   YPEVRFRKTREH"
     MSPSEYAREV AKRRTFAIIS HPDAGKTTIT EKVLLFGQAI QVAGTVKGRG SSQHAKSDWM        60
     EMEKQRGISI TTSVMQFPYH DCLVNLLDTP GHEDFSEDTY RTLTAVDCCL MVIDAAKGVE       120
     DRTRKLMEVT RLRDTPILTF MNKLDRDIRD PMELLDEVES ELRIACAPIT WPIGCGKLFK       180
     GVYHLYKDET YLYQSGKGHT IQEVRVIKGL DNPLLDTAVG EDLAAQLREE LELVQGASTE       240
     FEEEAFLNGQ LTPVFFGTAL GNFGVDHMLD GLVAWAPAPM PRMTDVRKVS ADEEKFSGFV       300
     FKIQANMDPK HRDRVAFMRV VSGRYDKGMK LRQVRTGKDV VIADALTFMA GDRAHVEEAY       360
     PGDIIGLHNH GTIQIGDTFT QGEEMKFTGI PNFAPELFRR IRLRDPLKQK QLLKGLVQLS       420
     EEGAVQVFRP VANNDLIVGA VGVLQFDVVV ARLKSEYNVE AIYESVNVST ARWVECDDVK       480
     KFDEFQRKNE LHLALDGGDN LAYIAPTMVN LNLTQERYPE VRFRKTREH                   529
//

If you have problems or comments...

PBIL Back to PBIL home page