(data stored in ACNUC7421 zone)

EMBL: CP001600.PE516

CP001600.PE516       Location/Qualifiers
FT   CDS             complement(552447..553310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0558"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67787"
FT                   /db_xref="GOA:C5BHI8"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI8"
FT                   /protein_id="ACR67787.1"
FT                   /translation="MNNRRALVSKLLPFSCVDGPGIRLVLFLQGCNLRCRGCHNPYTIG
FT                   RCDDCAQCVAACPHQALSLQAGKILWDALSCRQCDTCLQGCPRQANPMALSLSVDDVLM
FT                   QLRRQAAFIKGITVSGGEATLQLPFLLALFQAIRRDPGLQALDCLVDSNGELSEPGWTR
FT                   LIPWCDGVMVDLKAWGDERHRWLTGRGNRRILHSILWLAQRRRLAELRLLVIPQHSDYL
FT                   AHIDALAEFILLLDDVPVRLNAFHHHGVYGPASAWLTATKADIEQVAQALEARGVGAVI
FT                   RPALYL"
     MNNRRALVSK LLPFSCVDGP GIRLVLFLQG CNLRCRGCHN PYTIGRCDDC AQCVAACPHQ        60
     ALSLQAGKIL WDALSCRQCD TCLQGCPRQA NPMALSLSVD DVLMQLRRQA AFIKGITVSG       120
     GEATLQLPFL LALFQAIRRD PGLQALDCLV DSNGELSEPG WTRLIPWCDG VMVDLKAWGD       180
     ERHRWLTGRG NRRILHSILW LAQRRRLAEL RLLVIPQHSD YLAHIDALAE FILLLDDVPV       240
     RLNAFHHHGV YGPASAWLTA TKADIEQVAQ ALEARGVGAV IRPALYL                     287
//

If you have problems or comments...

PBIL Back to PBIL home page