(data stored in ACNUC7421 zone)

EMBL: CP001600.PE517

CP001600.PE517       Location/Qualifiers
FT   CDS             complement(553282..553698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0559"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67788"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI9"
FT                   /protein_id="ACR67788.1"
FT                   /translation="MPDSSDRGTTPGAHLPYGCEPDPVGHLMAVAPHHAYYPAGISDIL
FT                   TLDPTVKSNPQALMQLCLGAFSAGMREFTANVSGNDLVRVTGYMVRLSDLARYGQEGSR
FT                   LNTTRLAEEAARNTGMLERRARMISHEQQTRFSQ"
     MPDSSDRGTT PGAHLPYGCE PDPVGHLMAV APHHAYYPAG ISDILTLDPT VKSNPQALMQ        60
     LCLGAFSAGM REFTANVSGN DLVRVTGYMV RLSDLARYGQ EGSRLNTTRL AEEAARNTGM       120
     LERRARMISH EQQTRFSQ                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page