(data stored in ACNUC7421 zone)

EMBL: CP001600.PE525

CP001600.PE525       Location/Qualifiers
FT   CDS             560192..560683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0567"
FT                   /product="Nickel-dependent hydrogenases b-type cytochrome
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67796"
FT                   /db_xref="GOA:C5BHJ7"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ7"
FT                   /protein_id="ACR67796.1"
FT                   /translation="MRLTHWSVALGFLCNRLYLTVPGGTPHQLIGLTVAGLVLLRLLWG
FT                   VTWARGAARLSAFIPTPSALIHHLHELRTRTVPPVLHHNPLGALGIWATWLLLLLIALT
FT                   GWGQGTDLVFRWPVDVWHVWLVDALTLVVCVHIVAVFTLSFWLRRNLINAMLPGRHGGE
FT                   "
     MRLTHWSVAL GFLCNRLYLT VPGGTPHQLI GLTVAGLVLL RLLWGVTWAR GAARLSAFIP        60
     TPSALIHHLH ELRTRTVPPV LHHNPLGALG IWATWLLLLL IALTGWGQGT DLVFRWPVDV       120
     WHVWLVDALT LVVCVHIVAV FTLSFWLRRN LINAMLPGRH GGE                         163
//

If you have problems or comments...

PBIL Back to PBIL home page