(data stored in ACNUC7421 zone)

EMBL: CP001600.PE526

CP001600.PE526       Location/Qualifiers
FT   CDS             560868..560981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67797"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ8"
FT                   /protein_id="ACR67797.1"
FT                   /translation="MAHQGMDMFLIGIQIAKVYASMVTMSSGIATGASSWA"
     MAHQGMDMFL IGIQIAKVYA SMVTMSSGIA TGASSWA                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page