(data stored in ACNUC7421 zone)

EMBL: CP001600.PE527

CP001600.PE527       Location/Qualifiers
FT   CDS             complement(561260..561532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0569"
FT                   /product="phosphocarrier, HPr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67798"
FT                   /db_xref="GOA:C5BHJ9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ9"
FT                   /protein_id="ACR67798.1"
FT                   /translation="MSVTQTVEIKNRLGMHARPAMKLFELVQTFDADVILRNENGIEAE
FT                   ANSVIALLMLDSAQGGQIEIQATGPDERQALDAVVSLFNAGFDEE"
     MSVTQTVEIK NRLGMHARPA MKLFELVQTF DADVILRNEN GIEAEANSVI ALLMLDSAQG        60
     GQIEIQATGP DERQALDAVV SLFNAGFDEE                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page