(data stored in ACNUC7421 zone)

EMBL: CP001600.PE528

CP001600.PE528       Location/Qualifiers
FT   CDS             complement(561540..562391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0570"
FT                   /product="Uncharacterized P-loop ATPase protein family
FT                   (UPF0042)"
FT                   /note="Uncharacterised P-loop ATPase protein family
FT                   (UPF0042)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67799"
FT                   /db_xref="GOA:C5B725"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B725"
FT                   /protein_id="ACR67799.1"
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVELLPELARTLA
FT                   TRDTSAAVSIDVRNMPESPEVLETAMDHLPESFTPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSSKNLSLENAIDQENELLEPLRSRADLIIDTSEMSVHELAEMLRARLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQT
FT                   RSYLEQWLPALENNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRGKNVQSRHRTLEK
FT                   RK"
     MVLMIVSGRS GSGKSVALRA LEDMGFYCVD NLPVELLPEL ARTLATRDTS AAVSIDVRNM        60
     PESPEVLETA MDHLPESFTP QLLFLDADRN TLIRRYSDTR RLHPLSSKNL SLENAIDQEN       120
     ELLEPLRSRA DLIIDTSEMS VHELAEMLRA RLLGKREREL TMVFESFGFK HGIPIDADYV       180
     FDVRFLPNPH WDPKLRPMTG LDKPVAAFLD RHTEVHNFIY QTRSYLEQWL PALENNNRSY       240
     LTVAIGCTGG KHRSVYVAEQ LADYFRSRGK NVQSRHRTLE KRK                         283
//

If you have problems or comments...

PBIL Back to PBIL home page