(data stored in ACNUC7421 zone)

EMBL: CP001600.PE529

CP001600.PE529       Location/Qualifiers
FT   CDS             complement(562489..562953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0571"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67800"
FT                   /db_xref="GOA:C5B726"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C5B726"
FT                   /protein_id="ACR67800.2"
FT                   /translation="MSNDLTMPLSVVLTPECTRNAVHCASKKRVLEIISELAAAQLNLP
FT                   TQVVFDAILTRERMGSTGIGNGIAIPHGKLEEDTLRAIAVFIHLDQPINFDAIDNQPVD
FT                   LLFALLVPADQCKTHLQTLSLMAQKLSDKGVCRRLRAAQSDEGLYQIITE"
     MSNDLTMPLS VVLTPECTRN AVHCASKKRV LEIISELAAA QLNLPTQVVF DAILTRERMG        60
     STGIGNGIAI PHGKLEEDTL RAIAVFIHLD QPINFDAIDN QPVDLLFALL VPADQCKTHL       120
     QTLSLMAQKL SDKGVCRRLR AAQSDEGLYQ IITE                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page