(data stored in ACNUC7421 zone)

EMBL: CP001600.PE532

CP001600.PE532       Location/Qualifiers
FT   CDS             complement(564982..565707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0574"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67803"
FT                   /db_xref="GOA:C5B729"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C5B729"
FT                   /protein_id="ACR67803.1"
FT                   /translation="MARLIAENLAKSYKGRRVVENVSLTVNSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVPRDAGRIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLE
FT                   IRDDLNAEQRADRADELLDEFHIAHLRDNLGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKKIIEHLRDRGLGVLITDHNVRETLDVCERAYIVSQGNLIAYGSPD
FT                   EILADEQVKRVYLGEEFRL"
     MARLIAENLA KSYKGRRVVE NVSLTVNSGE IVGLLGPNGA GKTTTFYMVV GIVPRDAGRI        60
     IIDDDDISLL PLHARARRGI GYLPQEASIF RRLSVYDNLM AVLEIRDDLN AEQRADRADE       120
     LLDEFHIAHL RDNLGQSLSG GERRRVEIAR ALAANPKFIL LDEPFAGVDP ISVIDIKKII       180
     EHLRDRGLGV LITDHNVRET LDVCERAYIV SQGNLIAYGS PDEILADEQV KRVYLGEEFR       240
     L                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page