(data stored in ACNUC7421 zone)

EMBL: CP001600.PE533

CP001600.PE533       Location/Qualifiers
FT   CDS             complement(565714..566271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0575"
FT                   /product="cell envelope biogenesis protein YhbN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67804"
FT                   /db_xref="GOA:C5B730"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:C5B730"
FT                   /protein_id="ACR67804.1"
FT                   /translation="MKFKASTLKLRDLILAGALLSASASALAVTGDTDQPIHINSMQQS
FT                   LDMQGNVATFTGDVIVTQGTIKITADKVVITRPNGQQGSEIVEAYGNPVTFYQMQDNGK
FT                   PVEGHSQQLRYELAKDYVILTGKAFLKQLDSNIEGDRITYLVKQQQMEAFSDKGKRVTT
FT                   VLLPSQLQDKGSAKPAPQKKSN"
     MKFKASTLKL RDLILAGALL SASASALAVT GDTDQPIHIN SMQQSLDMQG NVATFTGDVI        60
     VTQGTIKITA DKVVITRPNG QQGSEIVEAY GNPVTFYQMQ DNGKPVEGHS QQLRYELAKD       120
     YVILTGKAFL KQLDSNIEGD RITYLVKQQQ MEAFSDKGKR VTTVLLPSQL QDKGSAKPAP       180
     QKKSN                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page