(data stored in ACNUC7421 zone)

EMBL: CP001600.PE534

CP001600.PE534       Location/Qualifiers
FT   CDS             complement(566246..566797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0576"
FT                   /product="Protein of unknown function (DUF1239)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67805"
FT                   /db_xref="GOA:C5B731"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:C5B731"
FT                   /protein_id="ACR67805.1"
FT                   /translation="MIILLSLIALALIGWNLADNSPDGAPTTQDPNTPNYQSQHTLTVV
FT                   YDPSGKLSYKLVAQDVQHYSEQGVTWFTRPVLTTFDPQAAATWSVRADKAKLAKDNRLY
FT                   LYGNVEVNSLTPTSQLERITTDNAQVNLVTQDISSDDEVTLYGSNFTSHGLKMRGNMRD
FT                   KTARLIDKVNTYYEIQSKHP"
     MIILLSLIAL ALIGWNLADN SPDGAPTTQD PNTPNYQSQH TLTVVYDPSG KLSYKLVAQD        60
     VQHYSEQGVT WFTRPVLTTF DPQAAATWSV RADKAKLAKD NRLYLYGNVE VNSLTPTSQL       120
     ERITTDNAQV NLVTQDISSD DEVTLYGSNF TSHGLKMRGN MRDKTARLID KVNTYYEIQS       180
     KHP                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page