(data stored in ACNUC7421 zone)

EMBL: CP001600.PE537

CP001600.PE537       Location/Qualifiers
FT   CDS             complement(568438..569427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0579"
FT                   /product="K+-dependent Na+/Ca+ exchanger-like protein"
FT                   /note="K+-dependent Na+/Ca+ exchanger homolog"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67808"
FT                   /db_xref="GOA:C5B734"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C5B734"
FT                   /protein_id="ACR67808.1"
FT                   /translation="MLLATLLMLIGLLLLVYGADRVVYGAAAVAHALGVAPLVIGMTIV
FT                   SMGTSLPELTVSLTATLHNQIDTAVGNVLGSNITNILLILGCAALIRPLSVRSDIVRRE
FT                   LPLTLGATILCGFLLYDNQLNRIDGAILMTFFGAFLWLMLKMAHRVMPGGQDSYTREQI
FT                   AELPRDTGLPVALLWIALGFIILPLASRMVIDNATVLARYLGVSELIIGLTVIAVGTSL
FT                   PELATACAGAIKGEHDIVLGNIIGSNTFNILVVLGIPALIGPRNPLIDDAAFARDYWVM
FT                   LAFTLVLTLLCLRRRHSIGRLTGALLLCAFIAYIGLLYMQPSLMLYWD"
     MLLATLLMLI GLLLLVYGAD RVVYGAAAVA HALGVAPLVI GMTIVSMGTS LPELTVSLTA        60
     TLHNQIDTAV GNVLGSNITN ILLILGCAAL IRPLSVRSDI VRRELPLTLG ATILCGFLLY       120
     DNQLNRIDGA ILMTFFGAFL WLMLKMAHRV MPGGQDSYTR EQIAELPRDT GLPVALLWIA       180
     LGFIILPLAS RMVIDNATVL ARYLGVSELI IGLTVIAVGT SLPELATACA GAIKGEHDIV       240
     LGNIIGSNTF NILVVLGIPA LIGPRNPLID DAAFARDYWV MLAFTLVLTL LCLRRRHSIG       300
     RLTGALLLCA FIAYIGLLYM QPSLMLYWD                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page