(data stored in ACNUC7421 zone)

EMBL: CP001600.PE539

CP001600.PE539       Location/Qualifiers
FT   CDS             570602..571309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0581"
FT                   /product="Protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67810"
FT                   /db_xref="GOA:C5B736"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C5B736"
FT                   /protein_id="ACR67810.1"
FT                   /translation="MLFSALVGRPEPGKQWPLLRRQLYSVGVQSLLIIIVSGLFIGMVL
FT                   GLQGYLVLTTYSAEASLGMMVALSLLRELGPVVTALLFAGRAGSALTAEIGLMKATEQL
FT                   SSLEMMAVDPLRRVVAPRFWAGVISMPLLTVIFVAVGIWGGSVVGVDWKGIDAGFFWSA
FT                   MQGAVDYRTDLLNCLIKSLIFAITVMWIALFNGYDAVPTSAGISRATTRTVVHASLAVL
FT                   GLDFVLTALMFGN"
     MLFSALVGRP EPGKQWPLLR RQLYSVGVQS LLIIIVSGLF IGMVLGLQGY LVLTTYSAEA        60
     SLGMMVALSL LRELGPVVTA LLFAGRAGSA LTAEIGLMKA TEQLSSLEMM AVDPLRRVVA       120
     PRFWAGVISM PLLTVIFVAV GIWGGSVVGV DWKGIDAGFF WSAMQGAVDY RTDLLNCLIK       180
     SLIFAITVMW IALFNGYDAV PTSAGISRAT TRTVVHASLA VLGLDFVLTA LMFGN            235
//

If you have problems or comments...

PBIL Back to PBIL home page