(data stored in ACNUC7421 zone)

EMBL: CP001600.PE540

CP001600.PE540       Location/Qualifiers
FT   CDS             571314..571847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0582"
FT                   /product="MCE related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67811"
FT                   /db_xref="GOA:C5B737"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:C5B737"
FT                   /protein_id="ACR67811.1"
FT                   /translation="MQTKKAEVWVGLFMLIALCAAIFLCLQVANVKSLGSAPTYRLYAT
FT                   FDNVGGLKARSPVKIGGVVIGRVAEISLDPQTYLPRVAMDIDRRYNHIPDTSSLAIRTS
FT                   GLLGEQYLALNVGFEDPEMGTAILKDGGTIQDTKSAIVLEDLIGQFLYKSGGESTNAPA
FT                   STAPAGNTPAPVAH"
     MQTKKAEVWV GLFMLIALCA AIFLCLQVAN VKSLGSAPTY RLYATFDNVG GLKARSPVKI        60
     GGVVIGRVAE ISLDPQTYLP RVAMDIDRRY NHIPDTSSLA IRTSGLLGEQ YLALNVGFED       120
     PEMGTAILKD GGTIQDTKSA IVLEDLIGQF LYKSGGESTN APASTAPAGN TPAPVAH          177
//

If you have problems or comments...

PBIL Back to PBIL home page