(data stored in ACNUC7421 zone)

EMBL: CP001600.PE541

CP001600.PE541       Location/Qualifiers
FT   CDS             571868..572518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0583"
FT                   /product="toluene tolerance protein Ttg2D"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67812"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:C5B738"
FT                   /protein_id="ACR67812.1"
FT                   /translation="MLKRIVMVALLCVAPWFSAQASAAPMLDQSNPYTLMNQAAAATFS
FT                   RLKSEQPRIRQDPDYLRTIVREELMPYVQVKYAGALVLGQYYRGVTPTQRAAYFKAFQS
FT                   YLEQVYGQALALYHGQRYEVAAERPLGDATIVTIRVTIFDNQGRPPVRLDFQWRKNTQT
FT                   GHWQAFDMIAEGVSMITTKQNEWAAILREKGVDGLTQQLIAVAKQPITLDNKQ"
     MLKRIVMVAL LCVAPWFSAQ ASAAPMLDQS NPYTLMNQAA AATFSRLKSE QPRIRQDPDY        60
     LRTIVREELM PYVQVKYAGA LVLGQYYRGV TPTQRAAYFK AFQSYLEQVY GQALALYHGQ       120
     RYEVAAERPL GDATIVTIRV TIFDNQGRPP VRLDFQWRKN TQTGHWQAFD MIAEGVSMIT       180
     TKQNEWAAIL REKGVDGLTQ QLIAVAKQPI TLDNKQ                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page