(data stored in ACNUC7421 zone)

EMBL: CP001600.PE542

CP001600.PE542       Location/Qualifiers
FT   CDS             572515..572829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0584"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67813"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C5B739"
FT                   /protein_id="ACR67813.1"
FT                   /translation="MTARGELRWRRDGAILYLQGVLECDSLGEIWQQRQALLTGIACLD
FT                   ISELSRVDSAGLALLLHVQNLRPEMPIPLRGISDRLRTLITLYNLQEIVPCAAPSANLA
FT                   "
     MTARGELRWR RDGAILYLQG VLECDSLGEI WQQRQALLTG IACLDISELS RVDSAGLALL        60
     LHVQNLRPEM PIPLRGISDR LRTLITLYNL QEIVPCAAPS ANLA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page