(data stored in ACNUC7421 zone)

EMBL: CP001600.PE543

CP001600.PE543       Location/Qualifiers
FT   CDS             572970..573224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0585"
FT                   /product="BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67814"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C5B740"
FT                   /protein_id="ACR67814.1"
FT                   /translation="MNNDQIKDVLMKALALQEVHVTGDGSHFQVIVVGELFAGMSRVKQ
FT                   QQAVYAPLMEFIADNRIHALTIKAYTPGEWQRDRKLSGL"
     MNNDQIKDVL MKALALQEVH VTGDGSHFQV IVVGELFAGM SRVKQQQAVY APLMEFIADN        60
     RIHALTIKAY TPGEWQRDRK LSGL                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page