(data stored in ACNUC7421 zone)

EMBL: CP001600.PE548

CP001600.PE548       Location/Qualifiers
FT   CDS             complement(577063..577455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0590"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67819"
FT                   /db_xref="GOA:C5B745"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:C5B745"
FT                   /protein_id="ACR67819.1"
FT                   /translation="MTWEYALIGLVVGIIIGALAMRFGNRKLRQQKTLQDELEKSKTDL
FT                   DQYRQELVNHFARSAELLDNMAKDYRQLYQHMATSSNNLLPDMPAHDNPFRYRLTEADN
FT                   DQAPVEIPPRDYSEGASGLLRADRHD"
     MTWEYALIGL VVGIIIGALA MRFGNRKLRQ QKTLQDELEK SKTDLDQYRQ ELVNHFARSA        60
     ELLDNMAKDY RQLYQHMATS SNNLLPDMPA HDNPFRYRLT EADNDQAPVE IPPRDYSEGA       120
     SGLLRADRHD                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page