(data stored in ACNUC7421 zone)

EMBL: CP001600.PE550

CP001600.PE550       Location/Qualifiers
FT   CDS             579040..579468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0592"
FT                   /product="50S ribosomal protein L13, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67821"
FT                   /db_xref="GOA:C5B747"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B747"
FT                   /protein_id="ACR67821.1"
FT                   /translation="MKTFTAKPETVKRDWYVVDASGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNAEKVAVTGNKRLDKKYFHHTGHIGGIKEATFEEMIARHPERVIEIA
FT                   VKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQPQVLDI"
     MKTFTAKPET VKRDWYVVDA SGKTLGRLAT ELARRLRGKH KAEYTPHVDT GDYIIVLNAE        60
     KVAVTGNKRL DKKYFHHTGH IGGIKEATFE EMIARHPERV IEIAVKGMLP KGPLGRAMFR       120
     KLKVYAGNEH NHAAQQPQVL DI                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page