(data stored in ACNUC7421 zone)

EMBL: CP001600.PE551

CP001600.PE551       Location/Qualifiers
FT   CDS             579483..579875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0593"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67822"
FT                   /db_xref="GOA:C5B748"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B748"
FT                   /protein_id="ACR67822.1"
FT                   /translation="MAENQYYGTGRRKSSAARVFIKPGSGKIVINQRSLEQYFGRETAR
FT                   MVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRSELRKAGFV
FT                   TRDARQVERKKVGLRKARRRPQFSKR"
     MAENQYYGTG RRKSSAARVF IKPGSGKIVI NQRSLEQYFG RETARMVVRQ PLELVDMVEK        60
     LDLYITVKGG GISGQAGAIR HGITRALMEY DETLRSELRK AGFVTRDARQ VERKKVGLRK       120
     ARRRPQFSKR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page