(data stored in ACNUC7421 zone)

EMBL: CP001600.PE553

CP001600.PE553       Location/Qualifiers
FT   CDS             580210..580851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0595"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="Glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67824"
FT                   /db_xref="GOA:C5B750"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C5B750"
FT                   /protein_id="ACR67824.1"
FT                   /translation="MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVDMGN
FT                   LPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGESRLFMH
FT                   QIERDWYSLLYKIEKGSAQEADAARKQLREELLAIAPVFSQKPFFMSDEFSLVDCYLAP
FT                   LLWRLPVLGIELSGAGAKELKGYMTRVFERDAFLASLTEVEREMRLHTRG"
     MAVAANKRSV MTLFSGPTDI FSHQVRIVLA EKGVSVEIEQ VDMGNLPQDL IDLNPYRTVP        60
     TLVDRELTLY ESRIIMEYLD ERFPHPPLMP VYPVARGESR LFMHQIERDW YSLLYKIEKG       120
     SAQEADAARK QLREELLAIA PVFSQKPFFM SDEFSLVDCY LAPLLWRLPV LGIELSGAGA       180
     KELKGYMTRV FERDAFLASL TEVEREMRLH TRG                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page