(data stored in ACNUC7421 zone)

EMBL: CP001600.PE556

CP001600.PE556       Location/Qualifiers
FT   CDS             complement(582028..582903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0598"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67827"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C5B753"
FT                   /protein_id="ACR67827.1"
FT                   /translation="MNTLAIDLGGTKLAAALVDANGQLSQRSEVATPVSGDPEALTKAL
FT                   SQLVTRYRGMAGRVAVASTGIIHQGILSALNPDNLGGLDRFPLQECIERLSALPCYLLN
FT                   DAQAAAWSEYLTLTPSGQDMAFITVSTGVGGGLVLNGRLQIGRGAFAGHIGHTLADPAG
FT                   PRCGCGRSGCVESIASGRAIAAAAQGDLTGLDARAIFQRAAADDAQAQRLIARSAQAIA
FT                   QLIADLRATLDIQCAVIGGSVGLAPDYLAQVQYFLRQLPHAYHTTLYPARHQRDAGLIG
FT                   AALWSRRETI"
     MNTLAIDLGG TKLAAALVDA NGQLSQRSEV ATPVSGDPEA LTKALSQLVT RYRGMAGRVA        60
     VASTGIIHQG ILSALNPDNL GGLDRFPLQE CIERLSALPC YLLNDAQAAA WSEYLTLTPS       120
     GQDMAFITVS TGVGGGLVLN GRLQIGRGAF AGHIGHTLAD PAGPRCGCGR SGCVESIASG       180
     RAIAAAAQGD LTGLDARAIF QRAAADDAQA QRLIARSAQA IAQLIADLRA TLDIQCAVIG       240
     GSVGLAPDYL AQVQYFLRQL PHAYHTTLYP ARHQRDAGLI GAALWSRRET I                291
//

If you have problems or comments...

PBIL Back to PBIL home page